PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4143_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 244aa    MW: 28191.6 Da    PI: 6.1041
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4143_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT+eEd++lv  +++ G g+W++ ++  g+ R++k+c++rw +yl
  cra_locus_4143_iso_4_len_919_ver_3 14 KGPWTPEEDQILVSFIQKNGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                                        79******************************99************97 PP

2Myb_DNA-binding54.33.1e-1767112148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                         rg++++eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  cra_locus_4143_iso_4_len_919_ver_3  67 RGNFSKEEEETIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.365961IPR017930Myb domain
SuperFamilySSF466894.21E-3110108IPR009057Homeodomain-like
SMARTSM007175.1E-141363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001677.67E-111661No hitNo description
PROSITE profilePS5129426.4862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-2765117IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002494.4E-1667112IPR001005SANT/Myb domain
CDDcd001671.01E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILVSFIQ KNGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SKEEEETIIK LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKKLKNYN  120
YKTPQEPKGH CSGDSTVAKS DSKTPKTEPV SPQDSCSDFS SVTNDNNHVL MIKNEEMESS  180
DYFPQIDESF WSEENENSAS EIHPRMVSDE EQVHQFQFPS IDDGMNFWYD LFIRAGDLPE  240
LPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091315.11e-113PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH44e-79MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A068TV821e-114A0A068TV82_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000443621e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154